PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Thecc1EG041430t1
Common NameTCM_041430
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Byttnerioideae; Theobroma
Family bZIP
Protein Properties Length: 383aa    MW: 42519 Da    PI: 9.6645
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Thecc1EG041430t1genomeCGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_1391.7e-12300349554
                       CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
            bZIP_1   5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkk 54 
                       +r+rr++kNRe+A rsR+RK+a++ eLe +  +L++eN +Lk+ +ee ++
  Thecc1EG041430t1 300 RRQRRMIKNRESAARSRARKQAYTVELELELNQLKQENAKLKQLVEENEQ 349
                       69************************************988855554433 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003381.8E-10296362IPR004827Basic-leucine zipper domain
PROSITE profilePS5021710.909298346IPR004827Basic-leucine zipper domain
CDDcd147072.15E-24300347No hitNo description
PfamPF001704.4E-10300350IPR004827Basic-leucine zipper domain
Gene3DG3DSA:1.20.5.1701.5E-12300352No hitNo description
SuperFamilySSF579598.75E-10300346No hitNo description
PROSITE patternPS000360303318IPR004827Basic-leucine zipper domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0033613Molecular Functionactivating transcription factor binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 383 aa     Download sequence    Send to blast
MALSESESVA YGGIKTGSLV QAPQSPHEEA TPDQSISCLN KQNSIFSLTL DEIQLKSGKT  60
FGSMNMDEFL ANLWNVEENQ VPSQLNQNEP INDKGMGSQP TLARQGSFSI PTPLCKKTVD  120
EVWFEIQKEL PQQRKANNIT DHEPPQRQQT FGEMTLEDFL IKAGVVQEPS GSSQQKKVTP  180
IIQTNGTNLD ANYGMGHVIG SSQQKMVTPI QNNNASLDAN FGMGHVMGLF PGHQIVANNL  240
ATAGNGYAAA YPIFTESKII MGESSNGAKN GSGTNSLLEP AVLHKKKRII DGPPEVVVER  300
RQRRMIKNRE SAARSRARKQ AYTVELELEL NQLKQENAKL KQLVEENEQR RKQEVLKRKQ  360
STHTQRKVDR MRTLRRTVSL GW*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007015839.10.0Basic-leucine zipper transcription factor family protein, putative
TrEMBLA0A061GVK60.0A0A061GVK6_THECC; Basic-leucine zipper transcription factor family protein, putative
STRINGPOPTR_0009s16610.11e-129(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM116522230
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G44460.18e-65bZIP family protein
Publications ? help Back to Top
  1. Motamayor JC, et al.
    The genome sequence of the most widely cultivated cacao type and its use to identify candidate genes regulating pod color.
    Genome Biol., 2013. 14(6): p. r53
    [PMID:23731509]